<div dir="ltr"><div>Hi,</div><div><br></div><div>(1)</div><div><br></div><div>Using biomart it is possible to retrieve a sequence of a transcript with information in the header about Exon Ranks in Transcript (see image below). In this example, I wonder what order, it is correct to assume that 2;5;4;3;1 refer to some indices of the exons as defined based on the canonical transcript? but what is the meaning of this unordered indices here for this particular transcript?</div>
<div><br></div><div>>GRM3|ENSG00000198822|ENST00000546348|ENSP00000444064|1416|2;4;3;1<br></div><div><div>MRRTNHEPEPGCRLTAAAATAVSSSSCQELSVRAPFNPNKDADSIVKFDTFGDGMGRYNV</div><div>FNFQNVGGKYSYLKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCC</div>
<div>WICIPCEPYEYLADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGF</div><div>MCTCMVVTVFIKHNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGL</div><div>GSSFAICYSALLTKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLI</div><div>LEAPGTRRYTLAEKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEA</div>
<div>KFIGFTMYTTCIIWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILF</div><div>QPQKNVVTHRLHLNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL*</div></div><div><br></div><div><br></div><div>(2)</div><div><br></div><div>What is Constitutive Exon feature in Biomart? See bottom of picture. For ENSG00000198822, exon 1 appears in all transcript but is not flagged as constitutive by this feature.</div>
<div><br></div><div><br></div><div><img src="cid:ii_145a82d28f8f3c93" alt="Inline images 1" width="800" height="243" style="margin-right: 25px;"><br></div><div><br></div><div>Regards,</div><div><br></div>-- <br><div dir="ltr">
G.</div>
</div>